PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00009.1.g11370.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 533aa    MW: 57163.9 Da    PI: 9.8975
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00009.1.g11370.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1177.4e-37392446559
                        zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                                    l+cprC s+ntkfCy+nny+++qPr+fCk C+ryWt+GGalrnvPvG+grrkn+
  Zjn_sc00009.1.g11370.1.am.mk 392 PLPCPRCRSRNTKFCYFNNYNVNQPRHFCKDCHRYWTAGGALRNVPVGAGRRKNR 446
                                   679**************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.8E-30393446IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.733393447IPR003851Zinc finger, Dof-type
PROSITE patternPS013610395431IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-19402446IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MGTATPALLL YSNEAISLSR RRKVNSTPVG SDFRSKLSTP SPCTPEEIAS PALSIPTAYS  60
EPEYGTGDGT RVVALRPGAA DQPEPWLVLS CRCEHHLLVA LAGHGRGSVK PPGRIPLGAT  120
RKYEAATGVA DHATLGRRAP IPSLFRNSKE TTQPCYQVHS LPNLLAAGMD TASQQCLYKN  180
GEILLESQTP HAPPPSSSST SARQPSPAIT ITLNKLVLLG RRREGTGRVS CPTPSAGDAP  240
FCRFLAFFPR PNPSFLSAPA HLAGVPLLLA SWLLLVRHRP PRFVVWMLSH VEMARGAGGI  300
KLFGKVITQC AAPAPSQEDP ASRAAFVRER PADPDESEQP TVKREAACAD HNFEKHQQHG  360
GAESKAAGGH PRSRQQDTAE ARAAAAASSA PPLPCPRCRS RNTKFCYFNN YNVNQPRHFC  420
KDCHRYWTAG GALRNVPVGA GRRKNRPLGP VVAAHHANHH QLQLHHHHHP AAAAAGLVLG  480
FPGDPSSPAS PVYADRWPVC PDRRCELRGK SVQRLSCVCA RAWAAVSGTG LGD
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824096e-92KC582409.1 Sorghum bicolor dof12 protein (dof12) gene, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64952851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.14e-27Dof family protein